General Information

  • ID:  hor002393
  • Uniprot ID:  Q90W22
  • Protein name:  Ghrelin-27
  • Gene name:  GHRL
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  High levels in stomach. Moderate levels in small intestine, pancreas and testis. Low levels in heart, lung and gall bladder.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GLTFLSPADMQKIAERQSQNKLRHGNM
  • Length:  27
  • Propeptide:  MNFGKAAIFGVVLFCLLWTEGAQAGLTFLSPADMQKIAERQSQNKLRHGNMNRRGVEDDLAGEEIGVTFPLDMKMTQEQFQKQRAAVQDFLYSSLLSLGSVQDTEDKNENPQSQ
  • Signal peptide:  MNFGKAAIFGVVLFCLLWTEGAQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q99ML8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q99ML8-F1.pdbhor002393_AF2.pdbhor002393_ESM.pdb

Physical Information

Mass: 353547 Formula: C130H216N42O40S2
Absent amino acids: CVWY Common amino acids: LQ
pI: 10.77 Basic residues: 5
Polar residues: 7 Hydrophobic residues: 7
Hydrophobicity: -85.56 Boman Index: -6754
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65.19
Instability Index: 7197.41 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  11546772
  • Title:  Bullfrog ghrelin is modified by n-octanoic acid at its third threonine residue.